Protein Info for Sama_0738 in Shewanella amazonensis SB2B

Annotation: thioredoxin 2 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 PF21352: Thio2_N" amino acids 4 to 29 (26 residues), 43.4 bits, see alignment 4.9e-15 PF00085: Thioredoxin" amino acids 38 to 137 (100 residues), 94.8 bits, see alignment E=5.8e-31 TIGR01068: thioredoxin" amino acids 41 to 138 (98 residues), 108.2 bits, see alignment E=1e-35 PF13098: Thioredoxin_2" amino acids 51 to 136 (86 residues), 34.8 bits, see alignment E=3.6e-12

Best Hits

Swiss-Prot: 47% identical to THIO2_ECOLI: Thioredoxin 2 (trxC) from Escherichia coli (strain K12)

KEGG orthology group: K03672, thioredoxin 2 [EC: 1.8.1.8] (inferred from 100% identity to saz:Sama_0738)

MetaCyc: 47% identical to reduced thioredoxin 2 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Thioredoxin" in subsystem Glycine reductase, sarcosine reductase and betaine reductase

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.8

Use Curated BLAST to search for 1.8.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S3J0 at UniProt or InterPro

Protein Sequence (140 amino acids)

>Sama_0738 thioredoxin 2 (RefSeq) (Shewanella amazonensis SB2B)
MILACPHCHGLNRVPDTRLSDAPSCGRCKSPLFTGAPMELTAENFDAHAVKSELPLVVDF
WAAWCGPCQSFAPVFSAAAEEIEPGFRFGKLDTESQQALAARFGIRSIPTLMVIKGGKIL
GQQAGAMPKQAFIQWLKQFS