Protein Info for Sama_0682 in Shewanella amazonensis SB2B

Annotation: putative glutathione S-transferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13409: GST_N_2
  • amino acids 11 to 72 (62 residues), 57.5 bits, E=3.2e-19
• PF02798: GST_N
  • amino acids 11 to 72 (62 residues), 37.8 bits, E=4e-13
• PF13417: GST_N_3
  • amino acids 11 to 76 (66 residues), 48.3 bits, E=2.1e-16
• PF13410: GST_C_2
  • amino acids 118 to 194 (77 residues), 28.9 bits, E=1.9e-10

Best Hits

KEGG orthology group: K04097, glutathione S-transferase [EC: 2.5.1.18] (inferred from 100% identity to saz:Sama_0682)

Predicted SEED Role

No annotation

MetaCyc Pathways

• 4-hydroxy-2-nonenal detoxification (1/4 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• pentachlorophenol degradation (3/10 steps found)
• gliotoxin biosynthesis (2/9 steps found)
• glutathione-mediated detoxification II (1/9 steps found)
• indole glucosinolate activation (intact plant cell) (3/12 steps found)
• camalexin biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Drug metabolism - cytochrome P450
• Glutathione metabolism
• Metabolism of xenobiotics by cytochrome P450

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

See A1S3D4 at UniProt or InterPro

Protein Sequence (224 amino acids)

>Sama_0682 putative glutathione S-transferase (RefSeq) (Shewanella amazonensis SB2B)
MLTLYIANKNYSSWSLRPWLLLTELGIPFEEKLQPFGDSDFKHFSPTAKVPCLLDEGEPV
WDSLAIIEYLAESYPGVWPENKQARAYARCAAAEMHSGFGTIRSICTMNCGIRVKLHAVE
EALEREWARIDELWQQGLTRFGGPFLGGQHFSAVDAFFAPIAFRVQTYAPKLSKASDAYV
AALLDLPGMQSWYQSALAEPWRDEAHEQEAREAGEIVSDFRLGQ