Protein Info for Sama_0681 in Shewanella amazonensis SB2B

Annotation: malate synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF20658: MSG_insertion
  • amino acids 32 to 100 (69 residues), 61.6 bits, E=3.4e-21

Best Hits

KEGG orthology group: K01638, malate synthase [EC: 2.3.3.9] (inferred from 100% identity to saz:Sama_0681)

Predicted SEED Role

"Malate synthase-related protein" in subsystem Serine-glyoxylate cycle

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• glyoxylate cycle (6/6 steps found)
• superpathway of glyoxylate bypass and TCA (10/12 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• glycolate and glyoxylate degradation II (2/2 steps found)
• chitin deacetylation (3/4 steps found)
• superpathway of glycol metabolism and degradation (5/7 steps found)
• L-arabinose degradation IV (2/8 steps found)
• D-xylose degradation IV (1/7 steps found)
• crotonyl-CoA/ethylmalonyl-CoA/hydroxybutyryl-CoA cycle (engineered) (1/14 steps found)
• superpathway of pentose and pentitol degradation (6/42 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.3.9

Use Curated BLAST to search for 2.3.3.9

Sequence Analysis Tools

See A1S3D3 at UniProt or InterPro

Protein Sequence (190 amino acids)

>Sama_0681 malate synthase (RefSeq) (Shewanella amazonensis SB2B)
MNMTMMNTQNQQQLHHFIGEAIAAVVNGAKRGVSLESATEFLDRRFPLARGSHKMVKSYV
VYYQHLLAFFEDGSHSGLETSSQFVALSGHKEEPCAILLKSGDIHVELTLDKNGRMGSAN
PAHIEDIQVESPGFCLRESEGCATEAISQCRNWLSLLHSAPCDDDCRQRNERRFTAKDGG
EYQLMSLGLF