Protein Info for Sama_0671 in Shewanella amazonensis SB2B

Annotation: arginine repressor (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 PF01316: Arg_repressor" amino acids 4 to 72 (69 residues), 78.5 bits, see alignment E=2.6e-26 TIGR01529: arginine repressor" amino acids 8 to 149 (142 residues), 146.5 bits, see alignment E=2.9e-47 PF02863: Arg_repressor_C" amino acids 80 to 147 (68 residues), 84.8 bits, see alignment E=2.8e-28

Best Hits

Swiss-Prot: 93% identical to ARGR_SHEFN: Arginine repressor (argR) from Shewanella frigidimarina (strain NCIMB 400)

KEGG orthology group: K03402, transcriptional regulator of arginine metabolism (inferred from 100% identity to saz:Sama_0671)

Predicted SEED Role

"Arginine pathway regulatory protein ArgR, repressor of arg regulon" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S3C3 at UniProt or InterPro

Protein Sequence (154 amino acids)

>Sama_0671 arginine repressor (RefSeq) (Shewanella amazonensis SB2B)
MQKNQDDLVKTFKALLKEERFGSQSEIVNALQAEGFSNINQSKVSRMLSKFGAVRTRNAK
QEMVYCLPAELGVPTAGSPLKNLVLDVDHNQAMIVVRTSPGAAQLIARLLDSIGKPEGIL
GTIAGDDTIFICPSSIKTIEDTLETVKSLFNYSE