Protein Info for Sama_0628 in Shewanella amazonensis SB2B

Annotation: MarR family transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 PF12802: MarR_2" amino acids 33 to 91 (59 residues), 48 bits, see alignment E=3.3e-16 PF01047: MarR" amino acids 35 to 92 (58 residues), 66.3 bits, see alignment E=5.5e-22 PF13463: HTH_27" amino acids 35 to 101 (67 residues), 26 bits, see alignment E=2.8e-09 PF13412: HTH_24" amino acids 43 to 82 (40 residues), 24.6 bits, see alignment E=4.5e-09 PF03551: PadR" amino acids 60 to 102 (43 residues), 27.9 bits, see alignment E=5.9e-10

Best Hits

Swiss-Prot: 40% identical to MGRA_STAAS: HTH-type transcriptional regulator MgrA (mgrA) from Staphylococcus aureus (strain MSSA476)

KEGG orthology group: None (inferred from 100% identity to saz:Sama_0628)

Predicted SEED Role

"Organic hydroperoxide resistance transcriptional regulator" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S380 at UniProt or InterPro

Protein Sequence (144 amino acids)

>Sama_0628 MarR family transcriptional regulator (RefSeq) (Shewanella amazonensis SB2B)
MQDTLALDRQVCFSLYRASNAMIRAYRPILDGLGLTYPQYLVMLVLWEEEGLSVKSLGER
LHLDSGTLTPLLKRLEQKGLVTRGRSEQDERVRVLHLTDDGRLLKRGARDIPDRMRCMVG
TGLEELAELKRLCDKAAKLLERES