Protein Info for Sama_0565 in Shewanella amazonensis SB2B

Annotation: LacI family transcription regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 PF00356: LacI" amino acids 13 to 55 (43 residues), 62.3 bits, see alignment 6e-21 PF13407: Peripla_BP_4" amino acids 70 to 286 (217 residues), 52.4 bits, see alignment E=1.1e-17 PF00532: Peripla_BP_1" amino acids 70 to 313 (244 residues), 107.2 bits, see alignment E=2.3e-34 PF13377: Peripla_BP_3" amino acids 177 to 335 (159 residues), 89 bits, see alignment E=7.7e-29

Best Hits

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 100% identity to saz:Sama_0565)

Predicted SEED Role

"Transcriptional regulator of mannoside utilization, LacI family" in subsystem Mannose Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S317 at UniProt or InterPro

Protein Sequence (339 amino acids)

>Sama_0565 LacI family transcription regulator (RefSeq) (Shewanella amazonensis SB2B)
MQAKTTKKNVTVIDVAKAAGVSKSTVSLVLQGSDKVNPATRDKVQAAMAELGYVYNREAA
SLRGKRSNLVAIVINDLTNPYSAQLAVGLEANIRRMGLFSMVVNSGEDKDTQGQLVQSLK
EYNVAAFVICPAPGTDADWVNQLAATVPVIHIMREITGAKVPTVLPDNQAGTLASTRHLL
SQGYTRIGFFGGNQRISDYGERLAGFKAALAEAGLEPAGVWETALTNRHGGRLAMAELLA
SSTRPEALVCFTDIVAYGAIEQLRQQGLMPGKDMAIVGFDDLEDSKLMTPALSSIAIDAD
ALGATVCQVLEDIRSGQQMQGLQRLPVQLKARGSSLRAC