Protein Info for Sama_0520 in Shewanella amazonensis SB2B

Annotation: putative polyhydroxyalkanoate depolymerase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR01840: esterase, PHB depolymerase family" amino acids 49 to 251 (203 residues), 144.9 bits, see alignment E=1.3e-46 PF10503: Esterase_PHB" amino acids 58 to 246 (189 residues), 82.8 bits, see alignment E=3.2e-27 PF00326: Peptidase_S9" amino acids 129 to 244 (116 residues), 29.8 bits, see alignment E=6.4e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_0520)

Predicted SEED Role

"Poly(3-hydroxyalkanoate) depolymerase (EC 3.1.1.-)" (EC 3.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.-

Use Curated BLAST to search for 3.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S2X4 at UniProt or InterPro

Protein Sequence (315 amino acids)

>Sama_0520 putative polyhydroxyalkanoate depolymerase (RefSeq) (Shewanella amazonensis SB2B)
MFKVSSLALKAATILASSLSLTVAAHASARAFEPVNDFGANPGALTASIYTPATNPGSAL
VVLLHGCVQDGIELADNSGLTGLAQEKQFAVLVPQQSFDNNVKRCFNWFSAQDTQVDSGE
MLSLKNMITQAQATTGAKRVYLVGLSAGGAMASAALVNYPDFFTAGAVIAGLPYPCADNL
TKAISCMKKGPAESTGELVSFVRKLHPDQASWPTLSIWTGTTDAVVHPQNARSLAAQWLQ
LSGVEAAPKVEEFTDYRISRWTDTKGQPLVDLVEINNMGHGISVNPAITNGGKEGDFLLK
APISSMDEIIRSWGL