Protein Info for Sama_0491 in Shewanella amazonensis SB2B

Annotation: phosphoribosylaminoimidazole-succinocarboxamide synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to PUR7_SHEAM: Phosphoribosylaminoimidazole-succinocarboxamide synthase (purC) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K01923, phosphoribosylaminoimidazole-succinocarboxamide synthase [EC: 6.3.2.6] (inferred from 100% identity to saz:Sama_0491)

Predicted SEED Role

"Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6)" in subsystem De Novo Purine Biosynthesis (EC 6.3.2.6)

MetaCyc Pathways

superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
superpathway of purine nucleotides de novo biosynthesis II (26/26 steps found)
superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
inosine-5'-phosphate biosynthesis I (6/6 steps found)
inosine-5'-phosphate biosynthesis II (5/5 steps found)
inosine-5'-phosphate biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S2U5 at UniProt or InterPro

Protein Sequence (367 amino acids)

>Sama_0491 phosphoribosylaminoimidazole-succinocarboxamide synthase (RefSeq) (Shewanella amazonensis SB2B)
MSLADSVLAVNNDLPIRTDKPVHSGKVRSVYWLTEADSARLIRERGYDVPADTPLAIMVI
SDRISAFDCIFHGEGDLRGIPGKGAALNAISNHWFGLFKENGLADSHILDIPHPFVWIVQ
KARPIKVEAIIRQYITGSMWRAYQKGERVFCGITLPEGLQKDQKLPELLITPSTKGILTG
IPGVPEQDDVNISRADIEANFEAFGFEKKEDIDLYEKLLKEGFGVISEALAKLDQVFVDT
KFEFGYVTDSNGNSKLIYMDEVGTPDSSRIWDGAAYRDGKIVENSKEGFRQFLLNHFPDP
DILLNKDRMPEREALARDNALPLDAMMNVSRTYTGIAEKVTGRKIELSDNPKAEIIAILK
EQYALVD