Protein Info for Sama_0490 in Shewanella amazonensis SB2B

Annotation: Zn-dependent protease with chaperone function (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 615 transmembrane" amino acids 33 to 62 (30 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details PF01435: Peptidase_M48" amino acids 145 to 335 (191 residues), 51 bits, see alignment E=8.1e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_0490)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S2U4 at UniProt or InterPro

Protein Sequence (615 amino acids)

>Sama_0490 Zn-dependent protease with chaperone function (RefSeq) (Shewanella amazonensis SB2B)
MEFNQGTLDELMLKAQQDLSSDQQSYKRKLNLYVWMAYGVILLLLLLFVGLVAGTVGLAF
TSSVFLVLLLKKKLIIPLLIIGWMLGRALFLGAGKPEGYRLRRAEAPLLFGLVNELTKSL
KTPRVHNIIVTPEFNAAMAQTPRWFVGGPTENTLIIGLELLMSLSKEELKAVLAHELGHL
SGDHAKFNGKIYRARAMWEQMMHSFESSGSLVTYPMRKFFSWYAPRFSAYSFALARLNEY
EADLSAAKQTSAATFQSALVKTSLLAEITDEDFWPQYYRRAYEQPAPDTLPYTAFKQFID
AGEFGDLPLRLAKVMAERTSPHNTHPCTKDRVEALGAFDEDVLKLRENNAWQLLGKSAHK
IIKEFNDNWLMYNGQEWQFQYQLAQEQLARLKELEPMDPNQLSLDQKEELAFLLDKFRRD
PERVVALYDGIMASKPHDLDTALRLAQLYAKAGNPRCLPLFRTCLAKDELVNDACMGAYG
YYLHQGDGNQANEWLDKLVAHGEIAERARQERITVGAKDPLMAPTLPKEAIDALAARLIA
IDRVEDVWLCQKSVQYFRDSPVVVLAIKVSGWTGKDKVLEQCFGQLPADWTSFIVTKDMD
SALFKKVQTKGTQII