Protein Info for Sama_0482 in Shewanella amazonensis SB2B

Annotation: PmbA protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 PF01523: PmbA_TldD_1st" amino acids 38 to 102 (65 residues), 49.8 bits, see alignment E=4.8e-17 PF19290: PmbA_TldD_2nd" amino acids 129 to 237 (109 residues), 77.6 bits, see alignment E=1.4e-25 PF19289: PmbA_TldD_3rd" amino acids 244 to 452 (209 residues), 229.9 bits, see alignment E=3.3e-72

Best Hits

Swiss-Prot: 60% identical to PMBA_ECO57: Metalloprotease PmbA (pmbA) from Escherichia coli O157:H7

KEGG orthology group: K03592, PmbA protein (inferred from 100% identity to saz:Sama_0482)

MetaCyc: 60% identical to metalloprotease subunit TldE (Escherichia coli)
3.4.24.-

Predicted SEED Role

"TldE protein, part of TldE/TldD proteolytic complex"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S2T6 at UniProt or InterPro

Protein Sequence (453 amino acids)

>Sama_0482 PmbA protein (RefSeq) (Shewanella amazonensis SB2B)
MNKSKTVSSNKIELELNALKDAVAMALDYANTLGTGAAEVAISKQQGLSVSTRLKEVETV
EFNKDGALGITVFRDGCKGSSSTSDLSPEAIRQAVKAADDIARYTSADPCNGLAEASLMA
KTVADLDLYHPESLTPEELTELAIRAEAAALDADPRIKNSDGASANAHTGIKVYGNSHGF
LNGYCSSRYSLSCVVIGEEDDGNMQRDYDYSISRKYAELLSPELVGQKAAAKTLSRLGGR
KIATGTMPVLFAHEVATGLIGHLISAISGSSLYRKSSFLLDGLDTQVFPEWLNIREEPHL
LAGLASAPYDSEGVATVDRDIIKDGLLATYLLTSYSARKLGMTNTGHAGGIYNWTLNDTG
VDFDALVRQMDKGLIVTEVMGQGVNMVTGDYSRGAAGFYVENGEIQYPVEEITIAGNLKD
MYRSIQAVSQDRDLRSSIRTGGILLDSMKVAGN