Protein Info for Sama_0456 in Shewanella amazonensis SB2B

Annotation: MSHA biogenesis protein MshN, putative (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 transmembrane" amino acids 39 to 59 (21 residues), see Phobius details PF13432: TPR_16" amino acids 218 to 271 (54 residues), 15.5 bits, see alignment 5.1e-06 amino acids 252 to 305 (54 residues), 24.7 bits, see alignment 7.2e-09 amino acids 321 to 377 (57 residues), 25.2 bits, see alignment E=4.9e-09 PF14559: TPR_19" amino acids 223 to 289 (67 residues), 34.1 bits, see alignment E=7.2e-12 amino acids 258 to 311 (54 residues), 25.9 bits, see alignment 2.6e-09 PF13428: TPR_14" amino acids 247 to 289 (43 residues), 24.3 bits, see alignment 9.1e-09

Best Hits

KEGG orthology group: K12284, MSHA biogenesis protein MshN (inferred from 100% identity to saz:Sama_0456)

Predicted SEED Role

"MSHA biogenesis protein MshN" in subsystem Mannose-sensitive hemagglutinin type 4 pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S2R0 at UniProt or InterPro

Protein Sequence (399 amino acids)

>Sama_0456 MSHA biogenesis protein MshN, putative (RefSeq) (Shewanella amazonensis SB2B)
MSVINQMLKDLDKRAEPHQLQQLPSTVAIPVNKSPGLPWRWLILLSLLLVAIALVLWNLK
ASNAKDAMVLSPMVSGQQAELNTASAAPVKMEPASNAQVSHVQEPADASSDTASGLAKEP
AGESDKSIKDTTGNGESETLAESVAVSFAGSANAPAPSETSVAGEATVLALQVNTSSEPP
VIDSSSVAMNTNTPSAGSMAVTEVVLPPAEQADRAMLKANGARDAGKLDEAMRQYAMALS
YEPARHEARRQLAALHYGQGQAGEAIKLLERGLVQFPEQSSFALLLGRLWREQGNKSQAL
AALDVIGDTDSLSRDKWLLVADIAREQDDHALAEAAYQKLLGTGMEKAQWWLGLAYAQDA
QGKMADARYHYQRALGTAGLSSDARAYIENRLMQLGDNQ