Protein Info for Sama_0421 in Shewanella amazonensis SB2B

Annotation: TMAO reductase system periplasmic protein TorT (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00532: Peripla_BP_1" amino acids 50 to 244 (195 residues), 40.6 bits, see alignment E=2.2e-14 PF13407: Peripla_BP_4" amino acids 54 to 299 (246 residues), 69.9 bits, see alignment E=2.6e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_0421)

Predicted SEED Role

"Periplasmic protein torT precursor" in subsystem trimethylamine N-oxide (TMAO) reductase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S2M5 at UniProt or InterPro

Protein Sequence (361 amino acids)

>Sama_0421 TMAO reductase system periplasmic protein TorT (RefSeq) (Shewanella amazonensis SB2B)
MTDTQGNMKIVTLLIAFIALTAFAEGPGLEMHIDGNAGIYQAPEKATRPWRICALLPHGK
DHYWWGVAWGLSQEAQRLGIEIGIYDAGGYDKLAEQKRQLKQCHRLKANGYIIAAITADG
LSAEVELLMADGIPVIDLVNGMNSEVSSRSLVSFVDMATAAAKYMLATEPNRPLNVAWFP
GPDGAAWVKDAETGLAEAIVGEDIRLVHGGYGMTETFVQADLVRGLVSRIQAEYIIANAV
AATVAAKYFGNRGKTKVIAFYSNPQTIELVRDGTLQATVTDSPVLQARVSVDLAVQWLEQ
GSAPRLVSPVIQVLTSENLAAADLSLTLPPEHQWMIHQDLSPIGGATALQRRSQLQAPKT
D