Protein Info for Sama_0415 in Shewanella amazonensis SB2B

Annotation: SPFH domain-containing protein/band 7 family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF01145: Band_7" amino acids 21 to 192 (172 residues), 124.1 bits, see alignment E=6.3e-40 PF16200: Band_7_C" amino acids 241 to 292 (52 residues), 32.6 bits, see alignment 6.7e-12

Best Hits

Swiss-Prot: 36% identical to QMCA_ECOL6: Protein QmcA (qmcA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 100% identity to saz:Sama_0415)

Predicted SEED Role

"Putative stomatin/prohibitin-family membrane protease subunit YbbK" in subsystem YbbK

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S2L9 at UniProt or InterPro

Protein Sequence (304 amino acids)

>Sama_0415 SPFH domain-containing protein/band 7 family protein (RefSeq) (Shewanella amazonensis SB2B)
MLLLTIAFLFILFILYKLMLIVQMREVAVIERLGKFRTVLEPGFHFLIPFVDRVAYRHDT
REQVLDVPAQSCISKDNTQLEVDGLVYLKVMDGKLASYGIEDYRLAAVNLAQTTMRSEIG
KLTLSETFSERDRLNESIVREIDKASEPWGIKVLRYEIKNITPSRHVIHTLEKQMEAERR
KRAEITLANAEKAAMINLSEGERQEAINLSEGEKQKRINEAKGTAAEIAIIARAKAEGMG
MVSSALAVQGGTKAMNMQLKEQFIKQIGEVMKNAEVSVVPAELAKMEGFFEGMDKVSHAL
TGKV