Protein Info for Sama_0328 in Shewanella amazonensis SB2B
Name: rpmB
Annotation: 50S ribosomal protein L28 (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to RL28_SHEAM: 50S ribosomal protein L28 (rpmB) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
KEGG orthology group: K02902, large subunit ribosomal protein L28 (inferred from 92% identity to sfr:Sfri_3827)MetaCyc: 82% identical to 50S ribosomal subunit protein L28 (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
No annotation
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A1S2D3 at UniProt or InterPro
Protein Sequence (78 amino acids)
>Sama_0328 50S ribosomal protein L28 (RefSeq) (Shewanella amazonensis SB2B) MSRVCQVTGKRPMVGNNRSHAKNATRRRFLPNLQNHRFWLETEKRFVQLRVSTKGMRIID KKGIEVVVAELRARGEKV