Protein Info for Sama_0294 in Shewanella amazonensis SB2B

Annotation: LacI family transcription regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 PF00356: LacI" amino acids 4 to 48 (45 residues), 61.3 bits, see alignment 1.2e-20 PF00532: Peripla_BP_1" amino acids 60 to 310 (251 residues), 116.4 bits, see alignment E=3.6e-37 PF13407: Peripla_BP_4" amino acids 62 to 308 (247 residues), 85.3 bits, see alignment E=1.1e-27 PF13377: Peripla_BP_3" amino acids 170 to 330 (161 residues), 119.2 bits, see alignment E=4.2e-38

Best Hits

Swiss-Prot: 37% identical to CYTR_SHIFL: HTH-type transcriptional repressor CytR (cytR) from Shigella flexneri

KEGG orthology group: K05499, LacI family transcriptional regulator, repressor for deo operon, udp, cdd, tsx, nupC, and nupG (inferred from 100% identity to saz:Sama_0294)

Predicted SEED Role

"Transcriptional regulator of mannoside utilization, variant 2, LacI family" in subsystem Mannose Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S299 at UniProt or InterPro

Protein Sequence (335 amino acids)

>Sama_0294 LacI family transcription regulator (RefSeq) (Shewanella amazonensis SB2B)
MTNIKKVSELAGVSTATVSRTLKSPERVSEQTRAKVMQAVKQAGYRPNWMATSVKTGKSN
AIVVLVPNLVNPFFMRIIEGIEQAAQEKGYCVLLGDTQGLQAREHEYASMVLTNRADGLI
QLDHSFPFSDNDADLAATIPMVSVCERIEGDRKYPFIELDNHAAGRALAHHLIGFGHKHF
GIIAGQRRSQIHHDRLTGIMSVLQGEGIDFKEDMLVGSSYSIETGIEGARELLSRNPRPS
AIFCFNDDIAIGAMFEIKSQGLKIPDDISVTGFDNVKVSAYMDPPLTTIDQPAYEMGRNA
VEVLVQQINRLPLARSRVIMPFHLLERGSTGPLKI