Protein Info for Sama_0265 in Shewanella amazonensis SB2B

Name: rpoZ
Annotation: DNA-directed RNA polymerase subunit omega (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 92 TIGR00690: DNA-directed RNA polymerase, omega subunit" amino acids 1 to 60 (60 residues), 90.8 bits, see alignment E=2.3e-30 PF01192: RNA_pol_Rpb6" amino acids 8 to 59 (52 residues), 68.4 bits, see alignment E=2.2e-23

Best Hits

Swiss-Prot: 100% identical to RPOZ_SHEAM: DNA-directed RNA polymerase subunit omega (rpoZ) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K03060, DNA-directed RNA polymerase subunit omega [EC: 2.7.7.6] (inferred from 100% identity to saz:Sama_0265)

Predicted SEED Role

"DNA-directed RNA polymerase omega subunit (EC 2.7.7.6)" in subsystem RNA polymerase bacterial (EC 2.7.7.6)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.6

Use Curated BLAST to search for 2.7.7.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S270 at UniProt or InterPro

Protein Sequence (92 amino acids)

>Sama_0265 DNA-directed RNA polymerase subunit omega (RefSeq) (Shewanella amazonensis SB2B)
MARVTVEDAVKQIGNRFDMILVAARRARQIAVQGKDPMVEEQNDKPTVIALREIEKGLVN
AGTLDADERQSVREREAAEIAAVAAIAEGRSL