Protein Info for Sama_0230 in Shewanella amazonensis SB2B

Name: rpsE
Annotation: 30S ribosomal protein S5 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01021: ribosomal protein uS5
  • amino acids 11 to 165 (155 residues), 236.1 bits, E=7.7e-75
• PF00333: Ribosomal_S5
  • amino acids 13 to 77 (65 residues), 105.4 bits, E=1.2e-34
• PF03719: Ribosomal_S5_C
  • amino acids 89 to 159 (71 residues), 104 bits, E=2.2e-34

Best Hits

Swiss-Prot: 100% identical to RS5_SHEAM: 30S ribosomal protein S5 (rpsE) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K02988, small subunit ribosomal protein S5 (inferred from 100% identity to saz:Sama_0230)

MetaCyc: 84% identical to 30S ribosomal subunit protein S5 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S5p (S2e)" in subsystem Ribosomal protein S5p acylation or Ribosome SSU bacterial

Sequence Analysis Tools

See A1S235 at UniProt or InterPro

Protein Sequence (168 amino acids)

>Sama_0230 30S ribosomal protein S5 (RefSeq) (Shewanella amazonensis SB2B)
MAKVEAQQQKDDLQEKLIAVNRVSKVVKGGRIFSFTALTVVGDGNGRVGYGYGKAREVPA
AIQKAMEKARRNMVTVELNEGTLHHPVKGRHTGSRVYMQPASQGTGIIAGGAMRAVLEVA
GVHNVLSKAYGSTNPINIVRATVDALTHMKSPAQVAAKRGLSVEEIRG