Protein Info for Sama_0190 in Shewanella amazonensis SB2B

Annotation: selenide, water dikinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 TIGR00476: selenide, water dikinase" amino acids 10 to 315 (306 residues), 453.1 bits, see alignment E=2.4e-140 PF00586: AIRS" amino acids 53 to 159 (107 residues), 85.9 bits, see alignment E=2.7e-28 PF02769: AIRS_C" amino acids 172 to 341 (170 residues), 80.1 bits, see alignment E=2e-26

Best Hits

Swiss-Prot: 81% identical to SELD_SHEB5: Selenide, water dikinase (selD) from Shewanella baltica (strain OS155 / ATCC BAA-1091)

KEGG orthology group: K01008, selenide, water dikinase [EC: 2.7.9.3] (inferred from 100% identity to saz:Sama_0190)

MetaCyc: 64% identical to selenide, water dikinase (Escherichia coli K-12 substr. MG1655)
Selenide, water dikinase. [EC: 2.7.9.3]

Predicted SEED Role

"Selenide,water dikinase (EC 2.7.9.3)" in subsystem Selenocysteine metabolism (EC 2.7.9.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.9.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S1Z5 at UniProt or InterPro

Protein Sequence (352 amino acids)

>Sama_0190 selenide, water dikinase (RefSeq) (Shewanella amazonensis SB2B)
MSSQLSQPIKLTEYSHGAGCGCKISPKVLGTILESQLPSFVDPNLLVGNASRDDAAVYKL
NDTTGIISTTDFFMPIVDDPFTFGRIAATNAISDIYAMGGTPMMAIAILGWPVNKLPAEV
AQQVVDGGRQACMDAGIMLAGGHSIDAPEPIFGLAVTGQLPLERLKQNNTAKAGDKLYLT
KPIGIGILTTAQKQKKLEDADAHIAPEAMCTLNKIGADIATLPGVSAMTDVTGFGLAGHL
LEMCQGATVDAELNLEAVPLLERAEHYLDLGCIPGGTHRNFDSYGEHLPNVSEREKALLC
DPQTSGGLLVAVCDEAEAALCELLSSHGITPVCIGELKAGPGRLLLKSGGLA