Protein Info for Sama_0142 in Shewanella amazonensis SB2B

Annotation: sensory box protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1069 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 422 to 444 (23 residues), see Phobius details PF08376: NIT" amino acids 57 to 272 (216 residues), 81.5 bits, see alignment E=5.1e-26 PF13188: PAS_8" amino acids 508 to 551 (44 residues), 29.2 bits, see alignment (E = 2.6e-10) TIGR00229: PAS domain S-box protein" amino acids 508 to 625 (118 residues), 73.4 bits, see alignment E=1.9e-24 PF00989: PAS" amino acids 509 to 616 (108 residues), 49.5 bits, see alignment E=1.6e-16 PF13426: PAS_9" amino acids 516 to 617 (102 residues), 59.3 bits, see alignment E=1.7e-19 PF08447: PAS_3" amino acids 530 to 611 (82 residues), 34.5 bits, see alignment 8.2e-12 PF00990: GGDEF" amino acids 630 to 787 (158 residues), 167.8 bits, see alignment E=6.7e-53 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 630 to 790 (161 residues), 139 bits, see alignment E=1.2e-44 PF00563: EAL" amino acids 807 to 1043 (237 residues), 254.5 bits, see alignment E=3.6e-79

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_0142)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S1U8 at UniProt or InterPro

Protein Sequence (1069 amino acids)

>Sama_0142 sensory box protein (RefSeq) (Shewanella amazonensis SB2B)
MASLHDYSLRQKLILFAVLPILTLAIFGIIRAMGLHQEFQTASRNTLAIQISGETAELVY
ALQHERNLSMNYLSDKPTITEIDLEAQQAKTDLSYRHLLQSHALARFSQDLASDEAKTFN
EVLGNIKTSANRLPLVRQAVQQHQWDEPGFFNRFNDELLLLINQLQHQTNDAAQSRAYSD
LLLILRIQELAARERGLMTRLLSADTLEPSTFNQLETLIKEQTHGEDLALDTFEEHHRVL
LQKLQSALPSQQVENIRAQVAQQRNISQLAWEMSDSLGYGGLIHSYKNFLLRGDEVYASQ
FNQKWDDMSLLLAKLKALPNLSAEQRGAIDEIKHTLLQYHMGIPKIRQLRAAGLPVQTID
AQLRVDDSRLRSALDTLRSPAPPVNARLWWELANERTAMLQDMARSVAAHIESLSQYQMR
MSLIYICTYAASALFTLILSLLLGRKITASFMGKIESIASDMQKMADDPKLELTIKTKGS
DEIAAMAEAMNKMLKERKKYRQALVRAAAVFEYSAEGIMVTDADNHIELINPAFSQITGY
SIEEVKGRNPSILSSHRNPPHLYDAMWESLRSTGKWEGEIWNRRKDGEVYPEYLAITLVR
DDEGQIVHHIGLFMDISRRKQYEQDIWYKANFDTLTDLPNRKLLSERLGHELKMAEHDGR
KLAVMVLDLDRFKYINDTQGHDCGDLLLKAVAKRLQTVMGSTDFIARLGGDEFVIVLPRL
AQEHAVEQYAKRLLQSMGDPFKVEQGSMSVSASLGIGLYPQDGLDVETLLSNAETAMYGA
KDEGRNHFKYFTQEMNLALIERLGMERDLRRAVANDEFCLFYQPVVDMESGEVTSLEALL
RWQDPEQGLVSPVRFIPVAEDMGLMGELGQWVMDKALADLARLHTLGFGLSMAINVSACQ
CHCKRQSLDEQLRSALSRHGIAPRHLHVEITESLLLDNSHHCLDTLNNIRDLGCAIYLDD
FGTGYSSLSYLKKFPISAIKIDKSFVEQLPGCESDASLVRAIVNMSKSLGMKLVAEGIES
KDQQAFLQALGSQFGQGYLYSRPLPFEELLPWLERHQHSQPDGFAYQNS