Protein Info for Sama_0057 in Shewanella amazonensis SB2B

Annotation: protein of unknown function DUF610, YibQ (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF04748: Polysacc_deac_2" amino acids 23 to 233 (211 residues), 247.6 bits, see alignment E=3.7e-78

Best Hits

KEGG orthology group: K09798, hypothetical protein (inferred from 100% identity to saz:Sama_0057)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S1L3 at UniProt or InterPro

Protein Sequence (250 amino acids)

>Sama_0057 protein of unknown function DUF610, YibQ (RefSeq) (Shewanella amazonensis SB2B)
MRYLIGLLLAAGMFTAHGAQLAIIIDDIGYRHTDEDVLSLPKDITLSVIPSSPLGVKLAS
KGHQRGHEIMLHLPMQSLNARPLGQGGLTSDMDEQEIKRKVDDAMVRIPFAKGANNHMGS
MLTQLDSHMLWVMERLKHNNLYFVDSLTTRYSKAGAKAEQVGVPLLKRHVFLDNDTSKRG
LEKQFKLMMEQAHQQGFVVAIAHPHPATVKFLNANLHRLRDEGINLVPTSELLPYRLAQK
QGTSPAVRLK