Protein Info for Sama_0045 in Shewanella amazonensis SB2B

Annotation: DNA processing protein DprA, putative (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 TIGR00732: DNA protecting protein DprA" amino acids 45 to 257 (213 residues), 245.3 bits, see alignment E=2e-77 PF02481: DNA_processg_A" amino acids 46 to 248 (203 residues), 247.9 bits, see alignment E=6.1e-78 PF17782: DprA_WH" amino acids 274 to 331 (58 residues), 39.9 bits, see alignment E=3.5e-14

Best Hits

Swiss-Prot: 47% identical to SMF_ECOLI: Protein Smf (smf) from Escherichia coli (strain K12)

KEGG orthology group: K04096, DNA processing protein (inferred from 100% identity to saz:Sama_0045)

Predicted SEED Role

"Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S1K1 at UniProt or InterPro

Protein Sequence (338 amino acids)

>Sama_0045 DNA processing protein DprA, putative (RefSeq) (Shewanella amazonensis SB2B)
MDVDELRQRLETEKDSLPLSPSLRSGLVVDYRLVDAALQWQDASTAHHLICFDDPRYPPL
LKTITDPPIFLFVRGQAEALLRPSVAMVGSRAASYSGLQTARMLASGLAGYGFAVVSGLA
AGIDGASHQGALAASGVTHAVLGTGIDEIYPKKHAHLANDILLRGCIVSEFWPGTPVFAG
NFPKRNRIVTGMALGTLVVEAARKSGSLISARLAMEQGREVFAVPGCVLDERHQGCHDLL
RQGVKLVCDAADIVEELGSMLSCQLDMLPQSPHMQAESGQELPYPELLASVEYETTPIDR
LVEHSGKPIDLVLEQILELELQGWVAAVPGGYVRVKRN