Protein Info for Sama_0026 in Shewanella amazonensis SB2B

Name: glyQ
Annotation: glycyl-tRNA synthetase subunit alpha (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 TIGR00388: glycine--tRNA ligase, alpha subunit" amino acids 8 to 301 (294 residues), 561.9 bits, see alignment E=1.4e-173 PF02091: tRNA-synt_2e" amino acids 10 to 293 (284 residues), 501.3 bits, see alignment E=3.5e-155

Best Hits

Swiss-Prot: 100% identical to SYGA_SHEAM: Glycine--tRNA ligase alpha subunit (glyQ) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K01878, glycyl-tRNA synthetase alpha chain [EC: 6.1.1.14] (inferred from 100% identity to saz:Sama_0026)

MetaCyc: 84% identical to glycine--tRNA ligase subunit alpha (Escherichia coli K-12 substr. MG1655)
Glycine--tRNA ligase. [EC: 6.1.1.14]

Predicted SEED Role

"Glycyl-tRNA synthetase alpha chain (EC 6.1.1.14)" (EC 6.1.1.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.14

Use Curated BLAST to search for 6.1.1.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S1I2 at UniProt or InterPro

Protein Sequence (301 amino acids)

>Sama_0026 glycyl-tRNA synthetase subunit alpha (RefSeq) (Shewanella amazonensis SB2B)
MTTKYDVKTFQGFILTLQDYWAQQGCAIVQPLDMEVGAGTFHPQTFLRALGPEPMSSAYV
QPSRRPTDGRYGENPNRLQHYYQFQVVLKPSPDNIQELYLGSLRALGIDTQIHDIRFVED
NWESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGIECSPVTGEITYGLERLAMYIQGVDS
VYDLVWTDGPMGRITYGDVFHQNEVEQSTYNFEHADVDFLFGMFDQCEKACQHLLSLETP
LPLPAYEQVMKASHAFNLLDARHAISVTERQRYILRVRTMAKAVAEAYYKAREALGFPMC
K