Protein Info for Shew_3860 in Shewanella loihica PV-4

Annotation: lysine exporter protein LysE/YggA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details transmembrane" amino acids 52 to 76 (25 residues), see Phobius details amino acids 116 to 138 (23 residues), see Phobius details amino acids 150 to 172 (23 residues), see Phobius details amino acids 192 to 210 (19 residues), see Phobius details PF01810: LysE" amino acids 16 to 206 (191 residues), 96.9 bits, see alignment E=5.6e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3860)

Predicted SEED Role

"Threonine efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJS5 at UniProt or InterPro

Protein Sequence (213 amino acids)

>Shew_3860 lysine exporter protein LysE/YggA (RefSeq) (Shewanella loihica PV-4)
MIDLALLPLYLTTVIALLLIPGPDMLLIASSSLSYGKKVGVYASFGNATSGLILTLLAAM
GVSALIALNPIALEVLRIAGGLYLLKMGWDCMRATPSQAPEIAGQKKLARQLYRRAVISN
LLNPKALIFFVLFLPQFVSSQLTASSAEQMLALGLVLNIMGLSFNLLLVALVGSLGKNLL
DNEKFRTNQNKFMGLIFFLLAIWLLASQLQSVG