Protein Info for Shew_3856 in Shewanella loihica PV-4

Annotation: tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 629 transmembrane" amino acids 601 to 619 (19 residues), see Phobius details TIGR00136: tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA" amino acids 7 to 622 (616 residues), 942.5 bits, see alignment E=5e-288 PF12831: FAD_oxidored" amino acids 8 to 141 (134 residues), 30.1 bits, see alignment E=8.3e-11 PF01134: GIDA" amino acids 8 to 399 (392 residues), 583.1 bits, see alignment E=7.3e-179 PF21680: GIDA_C_1st" amino acids 460 to 556 (97 residues), 87.6 bits, see alignment E=2e-28 PF13932: SAM_GIDA_C" amino acids 559 to 622 (64 residues), 83 bits, see alignment E=3.4e-27

Best Hits

Swiss-Prot: 100% identical to MNMG_SHELP: tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG (mnmG) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K03495, glucose inhibited division protein A (inferred from 100% identity to slo:Shew_3856)

MetaCyc: 73% identical to 5-carboxymethylaminomethyluridine-tRNA synthase subunit MnmG (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJS1 at UniProt or InterPro

Protein Sequence (629 amino acids)

>Shew_3856 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA (RefSeq) (Shewanella loihica PV-4)
MHFHERFDVIVVGGGHAGTEAALASARMGSKTLLLTHNIDTLGQMSCNPAIGGIGKGHLV
KEIDALGGAMAVATDHAGIQFRTLNSSKGPAVRATRAQADRALYRAKIQQILQNQPNLRL
FQQAVDDLIVGNDRVIGVVTQMGLAFEAPAIVLTAGTFLSGKIHIGLENYSGGRAGDPPS
ISLADRLRELPIRVGRLKTGTPPRIDANTINFDLMTEQKGDDPLPVMSFIGDVKDHPKQI
SCFITHTNERTHDIIRGGLDRSPMYSGVIEGIGPRYCPSIEDKINRFADKSSHQIFIEPE
GLNTNEIYPNGISTSLPFDVQLNLVRSIQGMENAEIIRPGYAIEYDYFDPRDLKNSLETK
AISGLFFAGQINGTTGYEEAGAQGLLAGMNASLQVQGKEAWCPRRDEAYLGVLVDDLSTL
GTKEPYRMFTSRAEYRLLLREDNADLRLTEKGRELGLVDDDRWAKFNAKREAIELELQRL
RSQWIHPNSPLVDALNPHLNTPITREATFEELLRRPELDYPKLMSVEGFGPAIEDQRAAE
QVQIQVKYSGYIQRQQDEIDKAIRHEKTGLPQDLDYQEVPGLSNEVIAKLNDHKPDTVGQ
ASRISGITPAAISILLVHLKKRGLLRKSA