Protein Info for Shew_3850 in Shewanella loihica PV-4

Annotation: F0F1 ATP synthase subunit C (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00137: ATP-synt_C
  • amino acids 10 to 73 (64 residues), 46.2 bits, E=2.2e-16
• TIGR01260: ATP synthase F0, C subunit
  • amino acids 20 to 75 (56 residues), 98.7 bits, E=7.2e-33

Best Hits

Swiss-Prot: 100% identical to ATPL_SHELP: ATP synthase subunit c (atpE) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K02110, F-type H+-transporting ATPase subunit c [EC: 3.6.3.14] (inferred from 96% identity to saz:Sama_3649)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Oxidative phosphorylation
• Photosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

See A3QJR5 at UniProt or InterPro

Protein Sequence (83 amino acids)

>Shew_3850 F0F1 ATP synthase subunit C (RefSeq) (Shewanella loihica PV-4)
METVLGMTAIAVALLIGMGALGTAIGFGLLGGKFLEGAARQPEMAPMLQVKMFIVAGLLD
AVTMIGVGIALFMLFTNPLGAML