Protein Info for Shew_3808 in Shewanella loihica PV-4

Annotation: carboxyl-terminal protease (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR00225: C-terminal processing peptidase" amino acids 52 to 366 (315 residues), 316.4 bits, see alignment E=1e-98 PF00595: PDZ" amino acids 92 to 157 (66 residues), 38.7 bits, see alignment E=2.1e-13 PF13180: PDZ_2" amino acids 100 to 179 (80 residues), 36 bits, see alignment E=1.4e-12 PF17820: PDZ_6" amino acids 117 to 157 (41 residues), 40 bits, see alignment 5e-14 PF03572: Peptidase_S41" amino acids 198 to 361 (164 residues), 185 bits, see alignment E=1.6e-58

Best Hits

KEGG orthology group: K03797, carboxyl-terminal processing protease [EC: 3.4.21.102] (inferred from 100% identity to slo:Shew_3808)

Predicted SEED Role

"Carboxyl-terminal protease (EC 3.4.21.102)" (EC 3.4.21.102)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.102

Use Curated BLAST to search for 3.4.21.102

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJM6 at UniProt or InterPro

Protein Sequence (401 amino acids)

>Shew_3808 carboxyl-terminal protease (RefSeq) (Shewanella loihica PV-4)
MSQMIRYFTCVALGLTLGLSITLFGHENAKEYQPKVNYPLLIDIISTVETYYVDKISQED
LIQAAIEGVFSKLDPYSNFLDSQAFSDIKDANKGEYFGFGIEIATEQNQVTIISPFPHSP
AANAGIQPGDRIVKVNNEAVTAKQLENVLEEIKFHSQHNLAINLSLSRANSEALFDVTLT
PSLIDVNSVEGELLDNGIGYIKLSSFQDDSTEDLIKLLTQWQNEPMTGLILDLRNNPGGL
LDQAIKIADIFLAKGRIISTRGRFFDANSDYFASPQTMFSKLPLTVLINKGSASASEVLA
AALQENKRATLIGEKSFGKGTVQSLIPTLIEGNAIKLTIAHYTTPKGRDIHAIGIEPDIN
IPGETMTAGQSMPIIDKQTPHEGAAHDKVIESAISWIKTNS