Protein Info for Shew_3787 in Shewanella loihica PV-4
Name: mogA
Annotation: molybdenum cofactor biosynthesis protein (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 66% identical to MOG_HELPY: Molybdopterin adenylyltransferase (mog) from Helicobacter pylori (strain ATCC 700392 / 26695)
KEGG orthology group: K03831, molybdopterin adenylyltransferase (inferred from 100% identity to slo:Shew_3787)MetaCyc: 54% identical to molybdopterin adenylyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-8344 [EC: 2.7.7.75]
Predicted SEED Role
"Molybdopterin biosynthesis molybdochelatase MogA"
MetaCyc Pathways
- molybdenum cofactor biosynthesis (2/3 steps found)
- bis(tungstenpterin) cofactor biosynthesis (1/4 steps found)
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.7.7.75
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A3QJK5 at UniProt or InterPro
Protein Sequence (177 amino acids)
>Shew_3787 molybdenum cofactor biosynthesis protein (RefSeq) (Shewanella loihica PV-4) MAKAKIGIVTVSDRASAGVYEDISGKAIIEVLGEYLTSEWEPVYEVIPDEQPIIEQTLIK MADQQDCCLIVTTGGTGPAKRDVTPEATEAVCDRMMPGFGELMRAESLKFVPTAILSRQT AGLRGDSLIVNLPGKPKSIRECLDAVFPAIPYCIDLMEGPYLECDEAVIKPFRPKAK