Protein Info for Shew_3782 in Shewanella loihica PV-4

Annotation: ABC-2 type transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 transmembrane" amino acids 27 to 46 (20 residues), see Phobius details amino acids 170 to 192 (23 residues), see Phobius details amino acids 218 to 242 (25 residues), see Phobius details amino acids 262 to 284 (23 residues), see Phobius details amino acids 296 to 317 (22 residues), see Phobius details amino acids 344 to 364 (21 residues), see Phobius details PF12679: ABC2_membrane_2" amino acids 8 to 363 (356 residues), 59 bits, see alignment E=9.3e-20 PF12698: ABC2_membrane_3" amino acids 29 to 360 (332 residues), 70.9 bits, see alignment E=2.2e-23 PF01061: ABC2_membrane" amino acids 167 to 324 (158 residues), 35.6 bits, see alignment E=1.5e-12 PF13346: ABC2_membrane_5" amino acids 176 to 331 (156 residues), 25.2 bits, see alignment E=2.3e-09

Best Hits

KEGG orthology group: K09696, sodium transport system permease protein (inferred from 100% identity to slo:Shew_3782)

Predicted SEED Role

"ABC-type Na+ efflux pump, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJK0 at UniProt or InterPro

Protein Sequence (378 amino acids)

>Shew_3782 ABC-2 type transporter (RefSeq) (Shewanella loihica PV-4)
MISSIITMVRKELTDAARDKRSVMAGLYYAIGAPLMMCGMFMILIGQITSPEALNITITH
GERAPDLVKYLASNEISQGDEADRKEIELVISPDYAANMAKSQAAEIVLIADNSNEKLQS
SIRRLEKALQQYSAEIGSLRLIARGIDPKVMQPIKVKVEDQATSDSKGGMILGVAIFMMV
YAVFISGMNLAIDTSAGERERNSLALLLSHPVSTRDIVLAKVAAVTIFAMLGLILTLVIS
KVAYGFVPWQELGFSVNINVDFILLMLAIGLPIALMAAALQLFVSFMAKSFKEAQSYLTI
VLIVPMMLSMAASYNIAPDTLQWLPISGQMQALIAFIKGKEIPMMQLALSSAITFVIALA
LALGMERSLKSEKIVFGL