Protein Info for Shew_3752 in Shewanella loihica PV-4

Annotation: MscS mechanosensitive ion channel (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 25 to 45 (21 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details amino acids 107 to 124 (18 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 172 to 197 (26 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 190 to 258 (69 residues), 54.9 bits, see alignment E=7.7e-19 PF21082: MS_channel_3rd" amino acids 335 to 399 (65 residues), 27 bits, see alignment E=5.1e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3752)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJH0 at UniProt or InterPro

Protein Sequence (416 amino acids)

>Shew_3752 MscS mechanosensitive ion channel (RefSeq) (Shewanella loihica PV-4)
MDQELRAQVSLWLTHFGIDSPSDGVSTGVMVFACLLIAFIGYVVVKRGVVSTMNIVIQRS
KVRWDDIFMQHRVLEKLAKLVPALILNILLPLALVEHPLLSSLADRLLDVAIVILFVRAV
YSVLDAGNEIADVNQISRRLPIKSFVQLLKLFMFFVAIVISISVLAEQSPVYFLSGLGVA
TGLVMLVFKDTILGFVAGIQLAANRMVSPGDWIQMDKYGADGAVEEVSLTTVKVQNWDKT
ITMIPAYALVSDAFKNWRGMSESGGRRIKRAVNIDIDSIAFLSDEQLKRLGKINLLKEYL
ARKEVEIAEFNAKIQDGDMPVNSRNLTNVGTFRAYLLEYMRKHPKVHQEMTLLVRQLAPT
TEGLPIEIYIFTNDTRWAFYEDIQADIFDHIYAILPQFNLRAFQAPTGADVRSLKG