Protein Info for Shew_3751 in Shewanella loihica PV-4

Annotation: lysine exporter protein LysE/YggA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 40 to 65 (26 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 118 to 139 (22 residues), see Phobius details amino acids 151 to 175 (25 residues), see Phobius details amino acids 187 to 205 (19 residues), see Phobius details PF01810: LysE" amino acids 16 to 205 (190 residues), 102 bits, see alignment E=1.5e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3751)

Predicted SEED Role

"Probable homoserine/homoserine lactone efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJG9 at UniProt or InterPro

Protein Sequence (207 amino acids)

>Shew_3751 lysine exporter protein LysE/YggA (RefSeq) (Shewanella loihica PV-4)
MNLDTWLLYLAAILLIAISPGTMAVLSMSHGIHFGKVRSLATALGSVSSALLLMFASAAG
LGALLSATEYGFTLLKYCGAAYLIYLGIKLILTKASAQGLDLQHIKGKGSPKQMFKEAFL
VGISNPKDLLFFGALFPQFIDITAPQGPQLAILALTWALVDFSFVMIYASMANVLAPKLR
ASNRLHWFDRTSSGVFLSLAAILVTKD