Protein Info for Shew_3742 in Shewanella loihica PV-4

Annotation: flagellar basal body-associated protein FliL-like protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF03748: FliL" amino acids 33 to 133 (101 residues), 67.8 bits, see alignment E=5.6e-23

Best Hits

KEGG orthology group: K02415, flagellar FliL protein (inferred from 100% identity to slo:Shew_3742)

Predicted SEED Role

"Flagellar biosynthesis protein FliL" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJG0 at UniProt or InterPro

Protein Sequence (135 amino acids)

>Shew_3742 flagellar basal body-associated protein FliL-like protein (RefSeq) (Shewanella loihica PV-4)
MKKFALLCLMLVTSVLSLGAYAEEEEVVDTYAYYGFEPDIVTNYISNRKKLGFVKISVEL
MVKVPEDLIVLEHHDPLLRAAIIEILGAQTEDKVKSLTGKEEIRRECYDTLNRLLEQEIG
KPLIVNLLFTKYLYD