Protein Info for Shew_3706 in Shewanella loihica PV-4

Annotation: 3-deoxy-D-manno-octulosonic-acid kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 PF06293: Kdo" amino acids 30 to 238 (209 residues), 191.5 bits, see alignment E=1.3e-60 PF01163: RIO1" amino acids 86 to 190 (105 residues), 26.5 bits, see alignment E=4.7e-10

Best Hits

Swiss-Prot: 44% identical to KDKA_VIBVY: 3-deoxy-D-manno-octulosonic acid kinase (kdkA) from Vibrio vulnificus (strain YJ016)

KEGG orthology group: K11211, 3-deoxy-D-manno-octulosonic acid kinase [EC: 2.7.1.-] (inferred from 100% identity to slo:Shew_3706)

MetaCyc: 58% identical to 8-amino-3,8-dideoxy-D-manno-octulosonate kinase (Shewanella oneidensis MR-1)
RXN-16750 [EC: 2.7.1.166]

Predicted SEED Role

"3-deoxy-D-manno-octulosonic acid kinase (EC 2.7.1.-)" (EC 2.7.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-

Use Curated BLAST to search for 2.7.1.- or 2.7.1.166

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJC4 at UniProt or InterPro

Protein Sequence (241 amino acids)

>Shew_3706 3-deoxy-D-manno-octulosonic-acid kinase (RefSeq) (Shewanella loihica PV-4)
MQIKPTDAGCIVFSQASLKAITPDWFTFDYWQDLGAITGSSKGRYTTWFVNPAPLSQAPE
EEWVLRHYYRGGMMEKFSRDAYLYTGLKRCRAIAEFNLLEQLFKEGFAVPEPVAAQIQRS
GPYYRGDIIIKRIPGARDLVAELSQGPMSDEKWQALGACIAKFHRRGVYHADLNAKNILL
AGENFTLIDFDRGELKQPDSKWQQSNLDRLLRSFNKEKGKAPELHFSQENWQLLLAGYAQ
A