Protein Info for Shew_3656 in Shewanella loihica PV-4

Annotation: glyoxalase/bleomycin resistance protein/dioxygenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 TIGR03645: lactoylglutathione lyase family protein" amino acids 6 to 167 (162 residues), 338.5 bits, see alignment E=3.1e-106 PF00903: Glyoxalase" amino acids 10 to 153 (144 residues), 59.2 bits, see alignment E=8.2e-20 PF13669: Glyoxalase_4" amino acids 12 to 126 (115 residues), 31.1 bits, see alignment E=3.8e-11 PF18029: Glyoxalase_6" amino acids 13 to 150 (138 residues), 29.2 bits, see alignment E=1.9e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3656)

Predicted SEED Role

"Glyoxalase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJ74 at UniProt or InterPro

Protein Sequence (167 amino acids)

>Shew_3656 glyoxalase/bleomycin resistance protein/dioxygenase (RefSeq) (Shewanella loihica PV-4)
MNNPAYPRTFSHIGISVPDLDAAVAFYTEVLGWYLIMKPTEIVEDDSAIGEMCTDVFGAG
WGSFRIAHLATGDKIGVELFQFANQQNPEDNFEYWKTGVFHFSVQDPDLEGLVEKIVAAG
GKKRMQAPRYYYPGEKPYRMIYMEDPFGNILEIYSHSYELTYSAGAY