Protein Info for Shew_3647 in Shewanella loihica PV-4

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 PF04445: SAM_MT" amino acids 25 to 253 (229 residues), 363.2 bits, see alignment E=2.5e-113

Best Hits

Swiss-Prot: 100% identical to RSMJ_SHELP: Ribosomal RNA small subunit methyltransferase J (rsmJ) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3647)

MetaCyc: 67% identical to 16S rRNA m2G1516 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-6731 [EC: 2.1.1.242]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.242

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJ65 at UniProt or InterPro

Protein Sequence (259 amino acids)

>Shew_3647 hypothetical protein (RefSeq) (Shewanella loihica PV-4)
MTASSTQPASVGIFFNRQYPTLEAVCDRWGLVFDENALFELVFEDNCLVLNKRDEPKLKG
IFVDFVSGAVAHRRKFGGGRGQAIAKAVGLKQGVTPSVVDGTAGLGRDAFVLASLGCNVT
MVERNPVVAALLEDGLRRAYEDADIGPWMQERMRLVHGSSLTALAELGEQVDVVYLDPMY
PHREKSALVKKEMRVFQSLVGADLDADGLLAPAMALASKRVVVKRPDYAEDLDGVKPNTR
IETKKNRFDVYVKAAMKSE