Protein Info for Shew_3638 in Shewanella loihica PV-4

Name: envZ
Annotation: osmolarity sensor protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 signal peptide" amino acids 12 to 16 (5 residues), see Phobius details transmembrane" amino acids 17 to 37 (21 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details PF00672: HAMP" amino acids 175 to 226 (52 residues), 45.1 bits, see alignment 1.5e-15 PF00512: HisKA" amino acids 232 to 290 (59 residues), 41.5 bits, see alignment E=1.7e-14 PF02518: HATPase_c" amino acids 332 to 436 (105 residues), 90.2 bits, see alignment E=1.9e-29

Best Hits

KEGG orthology group: K07638, two-component system, OmpR family, osmolarity sensor histidine kinase EnvZ [EC: 2.7.13.3] (inferred from 100% identity to slo:Shew_3638)

Predicted SEED Role

"Osmolarity sensory histidine kinase EnvZ"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJ56 at UniProt or InterPro

Protein Sequence (436 amino acids)

>Shew_3638 osmolarity sensor protein (RefSeq) (Shewanella loihica PV-4)
MSWFKRFLPRSAFSQTVLLIGSLLLVNQLVSYLSVAVYFIQPTYQQINQLIARQVNLLFV
DGVDVGREHLSMVDALNAKVRDDSMEIYNLKDAREAGVDRAAYYSLLSAQMSEHLGGKAE
VRIAQGKEFEIWIRPPQAPSVWIKVPLTGFNEFGLSPLTLYLMVIGALSVAGGWWFARKQ
NKPLKRLQKAAISVSRGDYPAPLPPSGSTEIIEVTNAFNQMSRSMQQLEQDRALLMAGIS
HDLRTPLTRIRLASEMMVEEDEYLKEGIVHDIEDMDAIINQFIAYIRQDQEANRELVQIN
DLLQDIAQAETNRDGEIVLALNECPEIPMQAVAVKRIISNLVENAFRYGNGWVQLSSSFD
GRRVGFGVEDNGPGIPSDQIPKLFQPFTQGDSARGSVGSGLGLAIIKRIVDRHQGQVVLT
NRPEGGLHAQVWLPLE