Protein Info for Shew_3617 in Shewanella loihica PV-4

Annotation: general secretion pathway protein F (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 transmembrane" amino acids 170 to 193 (24 residues), see Phobius details amino acids 224 to 243 (20 residues), see Phobius details amino acids 371 to 397 (27 residues), see Phobius details TIGR02120: type II secretion system protein F" amino acids 4 to 404 (401 residues), 561.9 bits, see alignment E=4.8e-173 PF00482: T2SSF" amino acids 72 to 194 (123 residues), 117.1 bits, see alignment E=2.5e-38 amino acids 274 to 396 (123 residues), 99 bits, see alignment E=9.6e-33

Best Hits

Swiss-Prot: 56% identical to GSPF_VIBCH: Type II secretion system protein F (epsF) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02455, general secretion pathway protein F (inferred from 100% identity to slo:Shew_3617)

MetaCyc: 46% identical to type II secretion system protein GspF (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"General secretion pathway protein F"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJ35 at UniProt or InterPro

Protein Sequence (406 amino acids)

>Shew_3617 general secretion pathway protein F (RefSeq) (Shewanella loihica PV-4)
MPAFEYKALNAQGKQQKGVVEADTARHARGQLRELRLMPLEITPVVEKEAKAKSGGFSFK
RGISVAELALITRQIATLVAAGLPVEEALKAVGQQCEKDRLASMVMAVRSRVVEGYSLAD
SMAEFPHIFDDLYRAMVASGEKSGHLEVVLNRLADYTERRQQLKTKMTQAMIYPIVLTLV
AISVIAILLAAVVPQVVGQFEHMGQELPWTTQFLIASSDFVRDYGLIVIGVIIALVVGAK
QLLRSAANRMKYDSAILKMPVVGRVSKGLNTARFARTLSILTASSVPLLDAMRIASEVLM
NVRVRAAVEEATARVREGTSLGAALANTKLFPPMMLYMITSGEKSGQLEQMLERAADNQD
REFESNVNIALGVFEPMLVVSMAAVVLFIVLAILQPILELNNMISG