Protein Info for Shew_3612 in Shewanella loihica PV-4

Annotation: general secretion pathway protein K (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details PF21687: T2SSK_1st" amino acids 106 to 217 (112 residues), 119.6 bits, see alignment E=1e-38 PF03934: T2SSK" amino acids 224 to 289 (66 residues), 64.9 bits, see alignment E=7.2e-22

Best Hits

KEGG orthology group: K02460, general secretion pathway protein K (inferred from 100% identity to slo:Shew_3612)

Predicted SEED Role

"General secretion pathway protein K"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJ30 at UniProt or InterPro

Protein Sequence (332 amino acids)

>Shew_3612 general secretion pathway protein K (RefSeq) (Shewanella loihica PV-4)
MNSLPGKQRGVALIVVLLIVAMIAIIATNINSRNQISVRRTINLAQYDQAYWYAISAEEL
AKKVLKQDLDDADEGKVHRQQYWAQADVVFPAEQGEIGGRISDLQACFNLNALAIETTEV
ENGQPKLPLPAVQFKGLLVALGMDDFSAERLTHTLKDYIDEDTVASPFGAEDADYESRTV
PYRAANTLMSHRSELRAVIGFSQEVYLKLAPYICVIPGYDRQVLNVNTIEVEQAALLAGM
FDNKISVGEAESIINQRPGDGYDSLDDFWSNGSISGLRQDKNLESSFSLKSQYFLLEAGA
KVDSATFRMQSVLRVGGNNQLDVLTRQYGGQK