Protein Info for Shew_3607 in Shewanella loihica PV-4

Annotation: putative methyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 TIGR00095: 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD" amino acids 4 to 188 (185 residues), 190 bits, see alignment E=1.8e-60 PF03602: Cons_hypoth95" amino acids 11 to 187 (177 residues), 194.4 bits, see alignment E=1.4e-61 PF05175: MTS" amino acids 52 to 136 (85 residues), 25.9 bits, see alignment E=7.4e-10

Best Hits

Swiss-Prot: 54% identical to RSMD_HAEIN: Ribosomal RNA small subunit methyltransferase D (rsmD) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K08316, ribosomal RNA small subunit methyltransferase D [EC: 2.1.1.171] (inferred from 100% identity to slo:Shew_3607)

Predicted SEED Role

"16S rRNA (guanine(966)-N(2))-methyltransferase (EC 2.1.1.171)" (EC 2.1.1.171)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.171

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QJ25 at UniProt or InterPro

Protein Sequence (195 amino acids)

>Shew_3607 putative methyltransferase (RefSeq) (Shewanella loihica PV-4)
MARNRPASGQVRIIAGQWRSRKLPIQDLEGLRPTTDRVRETLFNWIAGDLPGARVLDCFG
GSGALCFEALSRYAKYAKVFELQTGAAKQLKQNLATLKCDCAEVVQGDTLVQLKTPPTEG
FDVVFIDPPFRKGLAQACIDGLNDQAWLNEDALVYVETEREHPPLNLPGHWLPLKEKQAG
QVTYRLYRVERVEAK