Protein Info for Shew_3570 in Shewanella loihica PV-4

Annotation: two component transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 PF00072: Response_reg" amino acids 4 to 113 (110 residues), 103.9 bits, see alignment E=5.5e-34 PF00486: Trans_reg_C" amino acids 152 to 224 (73 residues), 66.8 bits, see alignment E=1.5e-22

Best Hits

Swiss-Prot: 59% identical to CPXR_SHIFL: Transcriptional regulatory protein CpxR (cpxR) from Shigella flexneri

KEGG orthology group: K07662, two-component system, OmpR family, response regulator CpxR (inferred from 100% identity to slo:Shew_3570)

MetaCyc: 59% identical to DNA-binding transcriptional dual regulator CpxR (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Copper-sensing two-component system response regulator CpxR" in subsystem Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QIY8 at UniProt or InterPro

Protein Sequence (227 amino acids)

>Shew_3570 two component transcriptional regulator (RefSeq) (Shewanella loihica PV-4)
MSQILLIDDDLGLAELLAQLLELEGFNLTLAHDGEAGLALALEQQFDLILLDVMLPKLNG
FEVLKALRSKKQTPVLMLTARGDEIDRVVGLEIGADDYLPKPFNDRELVARIKAIIRRTS
HQMDEQQPSILEFADIKLDPSRQEVLCQDQLLILTGTEFSLLYHMIQHSGEVLSKDNLSE
NVLGKKLMPFDRSLDMHLSNLRKKLPERADGRPRVKTLRGKGYIWLT