Protein Info for Shew_3565 in Shewanella loihica PV-4

Annotation: acriflavin resistance protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1036 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 328 to 347 (20 residues), see Phobius details amino acids 353 to 377 (25 residues), see Phobius details amino acids 379 to 404 (26 residues), see Phobius details amino acids 424 to 445 (22 residues), see Phobius details amino acids 451 to 475 (25 residues), see Phobius details amino acids 525 to 549 (25 residues), see Phobius details amino acids 870 to 889 (20 residues), see Phobius details amino acids 895 to 917 (23 residues), see Phobius details amino acids 924 to 946 (23 residues), see Phobius details amino acids 966 to 986 (21 residues), see Phobius details amino acids 998 to 1024 (27 residues), see Phobius details PF00873: ACR_tran" amino acids 1 to 1024 (1024 residues), 510.4 bits, see alignment E=1.4e-156 PF03176: MMPL" amino acids 817 to 1027 (211 residues), 31 bits, see alignment E=2.1e-11 PF02355: SecD_SecF_C" amino acids 874 to 1016 (143 residues), 22.3 bits, see alignment E=1.2e-08

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3565)

Predicted SEED Role

"Cation/multidrug efflux pump"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QIY3 at UniProt or InterPro

Protein Sequence (1036 amino acids)

>Shew_3565 acriflavin resistance protein (RefSeq) (Shewanella loihica PV-4)
MIAYITRHPTLANLLMLAFLLLGLLNMSSIKRETFPEFAPPYVMATVVYPGASPVEVEES
ICLRMEDAVDGLANIEEVKCDAQEGIASMRLKLEPKADLGRMLVDVQTQINAIQNFPAQI
EPPIVKELDWAEPVVDIAIVADTSWPHLKSYAEDVKRRLKIDAGVSLVSIAGFSDHQLRI
ELNQADMRRLGLTAAEIADKVGRQNVKMPAGNIELKDKNILLRFDERKVTPASLAEIIIA
SNPDGSVVRLGNIATISDRFELDEEHIQFNGSNAALIKVQKNKADDALRIKAKVSEFIEL
EQARAPDGVRLTMTNDLSSVLQDRLKMMITNGWQGIILVFLSMWLFFSLRYSFWVSAGLP
VAFLGGLYLMSLFGVSINLMSLVGLLMAIGIMMDDAIVIAESIASHIDRGMAPHEAVVKG
VQKVAPGVVSSFLTTVLIFSALLGLDGQMGAVLSAIPTVLIMVLTISLFEAFLILPNHLN
HSLAHAKAETKPNRIGELKAKFLTRFEAFRNNSLVTLVTFMVRWRYVSVGATIGLLLVSV
SLVVGGALKFVPFPDLDGDIAEARIILPPGSSLSQTQKVVETLIASAKRVGDRYTHEVED
EHELIRDITAQYNFNADAGESGPHVATVRLDLLSAETRNTLIEEFIRDWRIETGELAIPL
SLVFKQPTMGPAGRDIEIRLQGDDLDMLKQASVSLQSYLGQFDGISGILDDMRPGKEEIK
VSLRPGAESFGIDGQLVAAQLRSAYFGQLADEVQVGPENIEIEVRLNKLQAGDLQALANF
PIMLSDGSQLPLSSIALLQDQRSYVRIQRINGLRSVTVMADVDNQRANANETIAAIKREW
LAQVQQSYPQLRVDFEGSAKETAKTGSSMGKGFLIGLFGLFAILSFQFRSYLEPAVVMLA
IPLALIGVLWGHLLLGYNLSMPSIMGFISLAGIVVNDSILLVQYIRHHVDEGDSVHQAVV
SASRERFRAVFLTSLTTAAGLLPLLLETSLQAQVVQPLVVSIVFGIFASTLLVLFIIPCA
YAILADFDKVKPHTEL