Protein Info for Shew_3562 in Shewanella loihica PV-4

Annotation: LysR family transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 PF00126: HTH_1" amino acids 6 to 63 (58 residues), 74.7 bits, see alignment E=4.5e-25 PF03466: LysR_substrate" amino acids 89 to 290 (202 residues), 166 bits, see alignment E=7.9e-53

Best Hits

Swiss-Prot: 35% identical to YWBI_BACSU: Uncharacterized HTH-type transcriptional regulator YwbI (ywbI) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3562)

Predicted SEED Role

"LysR family regulatory protein CidR" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QIY0 at UniProt or InterPro

Protein Sequence (296 amino acids)

>Shew_3562 LysR family transcriptional regulator (RefSeq) (Shewanella loihica PV-4)
MNIPIKTLHYFLTLVETGNFTRAAEKSFITQPTLSKIIQRLEENLGQQLLHRNNQKIELT
QAGILLENSAREILGQWHRLQEDLTNLSGLKSGHLRLGVCPMMSSLIIDLLTAFRQQYPG
IELQMYEYGGFGCEQALLNNSLDIAFTALPTTHDIELANRALTRYPLLACLPKDHALAQQ
EAVTWQDFEAYPFILYNEDFSLAKLITRLSHKAGVQLNIAFRSGQWDFLATMVEAQMGVA
ILPEPICHKLQGSELVFKPIRPNLTWDLALIWRKDLPLTPAAQALLDLSEQAHLHP