Protein Info for Shew_3535 in Shewanella loihica PV-4

Annotation: RND family efflux transporter MFP subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 529 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF19335: HMBD" amino acids 53 to 79 (27 residues), 49.2 bits, see alignment (E = 1.5e-16) amino acids 97 to 122 (26 residues), 50.3 bits, see alignment (E = 6.7e-17) amino acids 161 to 188 (28 residues), 48.7 bits, see alignment (E = 2e-16) TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 212 to 513 (302 residues), 133.9 bits, see alignment E=3.1e-43 PF25919: BSH_CusB" amino acids 239 to 362 (124 residues), 63.1 bits, see alignment E=6e-21 PF25869: 3HB_CusB" amino acids 274 to 330 (57 residues), 34.3 bits, see alignment 6e-12 PF25954: Beta-barrel_RND_2" amino acids 367 to 441 (75 residues), 71 bits, see alignment E=2.8e-23 PF25967: RND-MFP_C" amino acids 448 to 506 (59 residues), 30.7 bits, see alignment 8.5e-11 PF25975: CzcB_C" amino acids 451 to 510 (60 residues), 36.5 bits, see alignment E=1.3e-12

Best Hits

KEGG orthology group: K07798, Cu(I)/Ag(I) efflux system membrane protein CusB (inferred from 100% identity to slo:Shew_3535)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QIV3 at UniProt or InterPro

Protein Sequence (529 amino acids)

>Shew_3535 RND family efflux transporter MFP subunit (RefSeq) (Shewanella loihica PV-4)
MSQVNSKNRGQKLAYLLSLFMVATPQLGHTQALEAKASQGHEAHVHQAGEKTYACPMHPE
ETSHEPGSRCPKCNMFLVEQETDASETSLTAGHEVTYVCPMHPEVTSHEPGSRCPKCNMF
LVAEEEEESTSTKVEPEMDHSQHDPLAQAKPAPLNGEPSIKYVCPMHAHIVSDVPGTCPI
CGMNLEKVEMSADTQQIEIDVSGSMQQALALKVAKAEKDTLWKFVQTVGQIGYDESQINH
VHARVNGWIEKLAITSVGDKISKGQLLYEIYSPDLINAQDDYLLALSSLQSSKDSRNYQD
LVRKAGLRLELLGMNQAQIKQLAKSKQTQYRVPFYAKADGIVKALSVRDGMYIQPATEVM
SVVDLSKVWVIADVFENEQSWLAIGQPTEVSVPAMDLKGIEGKIDYIYPELDPVTRSLRV
RIVLANNEVALRPNTLAKIEIYGGPNEDVLVIPQEALIQTGKENRVIVKQGDGSFLARKV
TVGMMSQGKAEILSGIEEGEQVVTSGQFLLDSEASLKGSLMRLSSGHQH