Protein Info for Shew_3520 in Shewanella loihica PV-4

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 841 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details transmembrane" amino acids 277 to 296 (20 residues), see Phobius details amino acids 303 to 324 (22 residues), see Phobius details amino acids 330 to 350 (21 residues), see Phobius details amino acids 379 to 401 (23 residues), see Phobius details amino acids 408 to 427 (20 residues), see Phobius details amino acids 462 to 482 (21 residues), see Phobius details amino acids 704 to 723 (20 residues), see Phobius details amino acids 730 to 751 (22 residues), see Phobius details amino acids 757 to 778 (22 residues), see Phobius details amino acids 785 to 806 (22 residues), see Phobius details amino acids 812 to 833 (22 residues), see Phobius details PF03176: MMPL" amino acids 212 to 422 (211 residues), 30.6 bits, see alignment E=9e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3520)

Predicted SEED Role

"FIG021862: membrane protein, exporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QIT8 at UniProt or InterPro

Protein Sequence (841 amino acids)

>Shew_3520 hypothetical protein (RefSeq) (Shewanella loihica PV-4)
MILRLSDRLSRLSANTRLVIWLVLLAAMALLAAQALSRGAGVQSDILAMLPKIQEDPLTQ
RAIDRVEQQLANRIYLGVVSPDQATAIKGAKQLLSALQGAPEAFTQVQSADMQGAQALNR
FYFPYRFHLLTTQQKALLATGQLAKLEANTLAQLYNAFGYANSQLLSQDPLLLYPELLKQ
LSPQRRLKVVDGILVGQELAQEARSNKDTQGNSVAIVMAQGVGSAFNPKAQELQLARLEE
AISQMQQSLEPKQEVTVIKGGALFHAAAATTQAKREVSSLGLASLIGVILLVWLAFRSMM
PLTIAALTIATSLLFALSATLWIFTQVHLLTLVFGTSLIGIAIDYSFHFYCERLQSQKAV
SGTATQTTGITATDAVARVFPAASLALLTTVIAYLAIGLTPFPGMQQVAVFCAAGLLGAY
LTLIFAYPKLANSTMRPGDRALGLATRYLNAMQTIARPINGAKGIAIALGLLLVAIFGLN
RLGVNDDIRALQQSPLSVTQGEQRLRQVMSGGTDNQFILVRAETAEALLTRLEALSPTLG
SLQHQGVLGNSVNLAHYLPSQASQQEAYRLQGQIYHKLPEVLAHLGLDGDLAPSLMASFE
ASANETITPDKFFASRAGELFAPLWLAPDGTDAQAQMQAQTQAQAKTQPSDKTSGSDGAT
YGAIVLLGGITDLDDLTQAISPLSGVTLVDKVQDISDVMAKYRSLTLSLLGLALVVAGLI
FSLRFGLKMALWITAVPALAALLTLAGLGLAGSPLTLFHALALILVFGIGVDYSLFFAES
HRGEGVMMAVFMSACSTLMAFGLLAFSQTPAIHYFGLTLLLGIGLTFVLSPFIHTLTRID
K