Protein Info for Shew_3503 in Shewanella loihica PV-4

Annotation: CaCA family Na(+)/Ca(+) antiporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 37 to 55 (19 residues), see Phobius details amino acids 67 to 91 (25 residues), see Phobius details amino acids 104 to 122 (19 residues), see Phobius details amino acids 124 to 145 (22 residues), see Phobius details amino acids 160 to 184 (25 residues), see Phobius details amino acids 199 to 222 (24 residues), see Phobius details amino acids 231 to 252 (22 residues), see Phobius details amino acids 264 to 282 (19 residues), see Phobius details amino acids 289 to 307 (19 residues), see Phobius details PF01699: Na_Ca_ex" amino acids 5 to 143 (139 residues), 110.4 bits, see alignment E=4.1e-36 amino acids 165 to 304 (140 residues), 114.8 bits, see alignment E=1.8e-37 TIGR00367: K+-dependent Na+/Ca+ exchanger homolog" amino acids 6 to 299 (294 residues), 247.8 bits, see alignment E=7.3e-78

Best Hits

KEGG orthology group: K07301, inner membrane protein (inferred from 100% identity to slo:Shew_3503)

Predicted SEED Role

"Sodium/calcium exchanger"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QIS1 at UniProt or InterPro

Protein Sequence (310 amino acids)

>Shew_3503 CaCA family Na(+)/Ca(+) antiporter (RefSeq) (Shewanella loihica PV-4)
MFTPLALIAGLLILILGAESLVRGASALALKLGVTPLIIGLTIVAFGTSAPELAVSLKSA
LAGNSGIALGNVVGSNIANIGLILGLTALVRPIGVQSMMVKRDIPLMLFASLLFWGLISD
GSLSQLDGALLCSMLIAYLGMNYLFDKQQADTESMELKPLAPLLAVVLLLVGIAMLVGGG
ILFVDGAVALARQLGMSELLIGLTIIAIGTSMPELITSLVAARRGESDIAIGNLVGSNLF
NILGILGITAIIHPITASVPKLDMLVMVSLALLLLPLAWSGLRVGRREGALLLLCYLVYL
GYLILSAQSL