Protein Info for Shew_3493 in Shewanella loihica PV-4

Annotation: acetyl-CoA hydrolase/transferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 PF02550: AcetylCoA_hydro" amino acids 68 to 174 (107 residues), 69.6 bits, see alignment E=3.8e-23 PF13336: AcetylCoA_hyd_C" amino acids 267 to 419 (153 residues), 223.8 bits, see alignment E=9.8e-71

Best Hits

Swiss-Prot: 51% identical to CAT2_CLOK5: 4-hydroxybutyrate coenzyme A transferase (cat2) from Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3493)

MetaCyc: 51% identical to 4-hydroxybutyrate coenzyme A transferase (Clostridium kluyveri)
2.8.3.M6 [EC: 2.8.3.M6]

Predicted SEED Role

"4-hydroxybutyrate coenzyme A transferase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.3.M6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QIR1 at UniProt or InterPro

Protein Sequence (428 amino acids)

>Shew_3493 acetyl-CoA hydrolase/transferase (RefSeq) (Shewanella loihica PV-4)
MPPIICNTAREAVALIQSGETLWTHSMGATPKLLLDALAEHALTRQDLTLLQLHTECAES
LSDPRLKGHLRHRCFFGGLPTRLLLQQGDADYVPIFLSEVPKLFRSGEQPIDTAIVQVSP
PDKHGICSLGISVEATLAACQVAGKIIAHINPCMPRTHGDGFIHYDKFAAVFEQSMPLPQ
HPLAASDETSLAIGRHVAKLVRDGDCLQMGIGAIPDAVLSCLTEHKDLGVHTELFSDGVL
NLVEQGVINNSRKKVHPGKLVTGFALGSQRLYDYVDDNPSVIFMDIEQVNDTSIIRKNPN
VMAINSALQVDISGQICADSLGTRIYSGVGGQMDFIRGAGLSEGGRSVIALPSTAAGGKV
SRIASVLSPGAGVVTTRAHVHYIVTEYGAANLRGKSLRERARALIDIAHPDFREQLCKET
FDMWGLRV