Protein Info for Shew_3492 in Shewanella loihica PV-4

Annotation: paraquat-inducible protein A (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 96 to 122 (27 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details amino acids 176 to 195 (20 residues), see Phobius details PF04403: PqiA" amino acids 76 to 196 (121 residues), 68 bits, see alignment E=4.7e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3492)

Predicted SEED Role

"conserved protein of unknown function; putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QIR0 at UniProt or InterPro

Protein Sequence (203 amino acids)

>Shew_3492 paraquat-inducible protein A (RefSeq) (Shewanella loihica PV-4)
MSQRSKWPQLLVILIALALLIPGLSLPMLSLDGQADKSKFAQTSIELMTEDGEMRGLLGS
VSAFLGFNELEGQVEIYRKHRSILGTVQDLMQSGNLLVGIMIATFSVIIPTLKLLAQAVL
VFARGSTATLLTRLIDAIGKWSMADVFVVAIIVSYLAGNAEDQMGELIIMHAQLEIGFWF
FTGYCLFAIASNIMMSKPKTTSA