Protein Info for Shew_3481 in Shewanella loihica PV-4

Annotation: DNA repair protein RadC (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 PF20582: UPF0758_N" amino acids 11 to 88 (78 residues), 101 bits, see alignment E=3.1e-33 TIGR00608: DNA repair protein RadC" amino acids 20 to 232 (213 residues), 239.2 bits, see alignment E=2.2e-75 PF04002: RadC" amino acids 112 to 231 (120 residues), 147 bits, see alignment E=2.6e-47

Best Hits

Swiss-Prot: 100% identical to Y3481_SHELP: UPF0758 protein Shew_3481 (Shew_3481) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K03630, DNA repair protein RadC (inferred from 100% identity to slo:Shew_3481)

Predicted SEED Role

"DNA repair protein RadC" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QIP9 at UniProt or InterPro

Protein Sequence (233 amino acids)

>Shew_3481 DNA repair protein RadC (RefSeq) (Shewanella loihica PV-4)
MAPRQGVFMAIKDWPQGEGPREKLLRSGVAQLSDAELLAVLLRNGLKGQSAVSLARVMLT
HFGGLRALFSASLSELCDIQGIGPVKYAQLQAAIELSKRIAQENLQRGKILSDPDLTRDY
LMRQLADRAYEVFAILLLDSQHRVIQFVELFRGTIDSASVYPREVVSLVLEKKAAAVIVC
HNHPSGGAEPSHADRRITERLKYALATIDVSLLDHMVVGDREIVSFAERGWID