Protein Info for Shew_3478 in Shewanella loihica PV-4

Annotation: N-acetylglutamate synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 TIGR01890: amino-acid N-acetyltransferase" amino acids 6 to 438 (433 residues), 623.2 bits, see alignment E=1.2e-191 PF00696: AA_kinase" amino acids 23 to 266 (244 residues), 116.4 bits, see alignment E=2.7e-37 PF00583: Acetyltransf_1" amino acids 322 to 410 (89 residues), 38.6 bits, see alignment E=1.8e-13 PF13508: Acetyltransf_7" amino acids 332 to 411 (80 residues), 36.9 bits, see alignment E=5.9e-13

Best Hits

Swiss-Prot: 83% identical to ARGA_SHEON: Amino-acid acetyltransferase (argA) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K14682, amino-acid N-acetyltransferase [EC: 2.3.1.1] (inferred from 100% identity to slo:Shew_3478)

MetaCyc: 64% identical to N-acetylglutamate synthase (Escherichia coli K-12 substr. MG1655)
Amino-acid N-acetyltransferase. [EC: 2.3.1.1]

Predicted SEED Role

"N-acetylglutamate synthase (EC 2.3.1.1)" in subsystem Arginine Biosynthesis extended (EC 2.3.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.1

Use Curated BLAST to search for 2.3.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QIP6 at UniProt or InterPro

Protein Sequence (440 amino acids)

>Shew_3478 N-acetylglutamate synthase (RefSeq) (Shewanella loihica PV-4)
MRTTELVEGFRHSASYVNAHRGKTFVVMLGGEALAQSQFRSIINDIALLHSLGIKIVLVH
GARPQIDEALAAHNLAPEYYNGVRISDEESFRVIKQVVGGLQLDITARLSMSLSNTPMQG
AQINVVSGNFVIAQPLGVDNGVDYCLSGKVRRIDVAGLRRQLDNHGIVLLGPVAASVTGE
CFNLTAEEVATQIAVKLKADKMIGFSAKEGILDSNGEVIAELMPTDAQRILSELTDEDNW
CVGTRAFLQASIDACRNGVARCHFVSYLDDGALLQELFSRDGIGTQIVTESAERLRRATI
ADIGGVLDLIRPLEQAGVLVRRSREQLEMEIEQFMLIERDGLVIGCAALYPFEEDNAGEF
ACLVVHPDYRDADRGSILLKNIIGQAKVRGYARLFALTTRSIHWFLEHGFQIVEVDALPN
KKKQLYNYQRKSKILALDLQ