Protein Info for Shew_3476 in Shewanella loihica PV-4

Annotation: transporter DMT superfamily protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 9 to 27 (19 residues), see Phobius details amino acids 39 to 61 (23 residues), see Phobius details amino acids 73 to 93 (21 residues), see Phobius details amino acids 103 to 121 (19 residues), see Phobius details amino acids 128 to 145 (18 residues), see Phobius details amino acids 151 to 167 (17 residues), see Phobius details amino acids 179 to 196 (18 residues), see Phobius details amino acids 208 to 230 (23 residues), see Phobius details amino acids 239 to 259 (21 residues), see Phobius details amino acids 269 to 287 (19 residues), see Phobius details TIGR00688: protein RarD" amino acids 8 to 258 (251 residues), 286.5 bits, see alignment E=9.3e-90 PF00892: EamA" amino acids 8 to 142 (135 residues), 53.4 bits, see alignment E=1.7e-18

Best Hits

Swiss-Prot: 56% identical to RARD_ECOLI: Protein RarD (rarD) from Escherichia coli (strain K12)

KEGG orthology group: K05786, chloramphenicol-sensitive protein RarD (inferred from 100% identity to slo:Shew_3476)

Predicted SEED Role

"Protein rarD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QIP4 at UniProt or InterPro

Protein Sequence (295 amino acids)

>Shew_3476 transporter DMT superfamily protein (RefSeq) (Shewanella loihica PV-4)
MADIEYRKGVALAICAYCLWGFAPLYFKLLNHVSATEILLHRVIWSFVFMLILMQFIGGF
AKLRALFRQPKQLGVLALTSVLIAGNWLLFIWAINNDHMLDASLGYFINPLINVLLGMVF
LQERLRKLQWAAVSLACAGVLIQLISFGSIPVVSLGLAASFGVYGLLRKKVNIDAKTGLL
VETAILVPVALLYLAMNLDDTSILENSWQMNLLLMAAGIVTSIPLLCFAGAATRIPLSML
GFFQYIGPSIMFIMAVSLFNEPFDLEKGITFAFIWSALVIFTLDLALKSRRKQTG