Protein Info for Shew_3455 in Shewanella loihica PV-4

Annotation: UDP-N-acetylmuramoylalanine--D-glutamate ligase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 7 to 23 (17 residues), see Phobius details PF21799: MurD-like_N" amino acids 7 to 95 (89 residues), 101.4 bits, see alignment E=4.2e-33 TIGR01087: UDP-N-acetylmuramoylalanine--D-glutamate ligase" amino acids 8 to 434 (427 residues), 396.4 bits, see alignment E=9.9e-123 PF08245: Mur_ligase_M" amino acids 114 to 280 (167 residues), 84 bits, see alignment E=2.2e-27 PF02875: Mur_ligase_C" amino acids 302 to 413 (112 residues), 67.5 bits, see alignment E=3.1e-22

Best Hits

Swiss-Prot: 70% identical to MURD_SHEON: UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K01925, UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC: 6.3.2.9] (inferred from 100% identity to slo:Shew_3455)

Predicted SEED Role

"UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC 6.3.2.9)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QIM3 at UniProt or InterPro

Protein Sequence (443 amino acids)

>Shew_3455 UDP-N-acetylmuramoylalanine--D-glutamate ligase (RefSeq) (Shewanella loihica PV-4)
MASQYTHIVLGLGATGLSVVRYLIKQGITPLVMDSRENPPGRETLSQEFPEVLLLTGGFD
CRYLVQASQIVVSPGIPLDTAEVRAAVDMGIDIVGDVELFARALADRPACVIGITGSNGK
STVTTLVGEMAAKAGLKVAVGGNIGVPVLDLLDGDHELFVLELSSFQLETTSSLNCISAT
CLNISEDHMDRYSDLESYRQAKLRLYDQTKLAIFNRDDLLTRPNEPMNQNSFGLSLPEGD
EWGVNHGVLVHGTTEYVAGAQVSLVGSHNQANLLVAMALADSAGVDKAAMVEVAKQFKGL
AHRCELVGKHQGVSYVNDSKATNVGATIAALQGLSDHEGQIILIAGGDGKGADFSTLRGA
LLGVGQVITLGKDGDRIAEQFDGAIRVESMQEAVAQAAQLAKPGDLVLLSPACASLDMYA
NFMARGDDFRAQVEALAQEVMHA